PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00034268-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 301aa    MW: 34255.6 Da    PI: 9.0139
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00034268-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.5e-14194252563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       ++++r+ +NRe+ArrsR RK++ ++eL+  +++L aeN    ++ +  ++++++++ ++
  PSME_00034268-RA 194 RKQKRMLSNRESARRSRMRKQQHLDELRAQIAQLRAENNHILSKFNLATQHYSQVEEQN 252
                       789**************************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-17190254IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.105192255IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-9194251No hitNo description
PfamPF001701.6E-10194252IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-11194245No hitNo description
CDDcd147023.02E-22195246No hitNo description
PROSITE patternPS000360197212IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MMMVVRTKDL DTHRMKRLRG INESIEHWID WFDLVRAENC EQELERQVIF PLLSGSSQVP  60
LLASSALLKD FGVRNINMSG VGPVVKTNQQ TSSSFCFHPP MATAGLTNLQ TWESNSRLKL  120
SPNLPSKPAA EISSNLMPPP PPTTKVNLPP CTTNSTGSSS SLTYGSCPPS SSHSGSEEED  180
QQKQEQKKNV IDERKQKRML SNRESARRSR MRKQQHLDEL RAQIAQLRAE NNHILSKFNL  240
ATQHYSQVEE QNRVLRSQAI DLYQKLQILI SMQQQQQLQQ QQQQQSLGNF DHSEFQNSPF  300
C
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206213RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1091190.0BT109119.1 Picea glauca clone GQ03204_O11 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S8793e-45A0A0C9S879_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_5460_974 transcribed RNA sequence
TrEMBLA0A0C9SA043e-45A0A0C9SA04_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_5459_968 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.19e-24basic leucine-zipper 44